Visakhapatnam Digital Life Sciences
The dedicated digital solutions network for Life Sciences in Visakhapatnam, India — part of the Digital World Networks global infrastructure serving South Asia.
20
Solutions Listed
20
Categories
1
Verified Programs
Visakhapatnam Life Sciences Solutions
Digital Life Sciences Providers
Verified digital life sciences solutions available to Visakhapatnam businesses and residents through the Digital World Networks platform.
Research & Reference Management
EndNote
endnote.com
The reference manager trusted by millions of researchers at the world's top universities. Summarize, translate, organize, and cite with ease — building ideas, one citation at a time.
Benchling
Website
benchling.com
Benchling is a cloud-based platform for biotechnology research and development and the only biology-first platform for scientific data
https://digitalinsights.qiagen.com
QIAGEN Digital Insights
digitalinsights.qiagen.com/products/clc-genomics-workbench
CLC Genomics Workbench Premium delivers flexible, scalable sequence analysis software for NGS data interpretation in any research environment.
https://labcollector.com
LabCollector
scinote.net
SciNote is a cloud-based ELN software with lab inventory, compliance, & team management tools used by the FDA, USDA and scientists in 100+ countries.
https://nanoporetech.com
Oxford Nanopore Technologies
pacb.com
PacBio highly accurate long-read sequencing provides the most comprehensive view of genomes, transcriptomes, and epigenomes.
https://rosalind.bio
Rosalind Bioinformatics
genestack.com
A global player in life science R&D informatics. We provide pharma, agriscience and consumer goods organizations with Life Science Data management
https://usegalaxy.org
Galaxy Project (UseGalaxy)
seqera.io
Seqera empowers your teams with a unified environment that delivers high-throughput, cost-effective computation
https://www.avantorsciences.com
Avantor Science
cambridgescientific.com
We are a service company specializing in the sale of refurbished laboratory and scientific equipment for a variety of industries.
https://www.benchsci.com
BenchSci
indicalab.com
Indica Labs uses AI to power its HALO software suite for an end-to-end digital pathology workflow from research to diagnostics.
https://www.bio-rad.com
Bio-Rad Laboratories
abcam.com
Abcam, the leading supplier of protein research tools to life scientists. Abcam offers high-quality biological reagents and tools
https://www.bio-techne.com
Bio-Techne
cellsignal.com/products
For 25 years, the world's most trusted antibodies ; Featured Products & Services
https://www.biocompare.com
Biocompare
labplanet.com
We stock a wide selection of laboratory glassware, medical supplies,lab equipment, microscopes,chromatography products and so much more.
https://www.bioconductor.org
Bioconductor
biobam.com
BioBam is a leading bioinformatics solution provider which accelerate research in disciplines such as agricultural genomics, microbiology and environmental NGS
https://www.biovision.com
BioVision
zageno.com
ZAGENO offers a large marketplace with AI search, automated order tracking, real-time cost control, and 100% lab supply ordering automation.
https://www.caymanchem.com
Cayman Chemical
vectorlabs.com
Your Partner in Science. Explore antibodies, kits, and reagents for cutting-edge research. Elevate your experiments with us.
https://www.cellsignal.com
Cell Signaling Technology
scbt.com
SCBT is a leading producer of monoclonal antibodies, RNAi, CRISPR KO/Activation products and chemicals for research.
https://www.dnastar.com
DNASTAR Lasergene
macvector.com
MacVector is a sequence analysis application for Macintosh computers that lets you manipulate, document and analyze DNA and protein sequences.
https://www.fishersci.com
Fisher Scientific
sigmaaldrich.com
MilliporeSigma offers consultative services to help customers optimize their workflows and overcome complex challenges in areas of life science research.
https://www.flowjo.com
FlowJo
denovosoftware.com
FCS Express gets you from raw data to easily-understandable, beautifully formatted, presentation-ready results more easily and in less time than any other
https://www.genewiz.com
Genewiz by Azenta
en.novogene.com
Novogene selects the best technology from Illumina, Pacific Biosciences, Oxford Nanopore and Life Technologies, in our state-of-the-art sequencing centers i
About This Network
Visakhapatnam's dedicated
Life Sciences city network
Visakhapatnam's position as India's South Asia hub makes it a key market for digital life sciences solutions. Digital life sciences encompasses the data, research, and technology platforms that support pharmaceutical development, clinical trials, genomics, and medical research. This city network connects Visakhapatnam businesses and residents with 20 verified life sciences providers across 20 solution categories, all operating within or serving the Visakhapatnam market through the Digital World Networks platform.
As India's major port city, Visakhapatnam plays a critical role in regional trade flows, digital logistics platforms, and maritime technology networks across South Asia.
Digital life sciences encompasses the data, research, and technology platforms that support pharmaceutical development, clinical trials, genomics, and medical research. Tools include laboratory information management systems (LIMS), clinical data management platforms, and bioinformatics pipelines for analyzing genetic and molecular data. Research institutions, biotech firms, and pharmaceutical companies are the primary users.
L1
DigitalWorldNetworks.com
Global parent
L4
DigitalLifeSciencesNetworks.com
Industry network
L5
visakhapatnamdigitallifesciences.com
This network
Challenges & Opportunities
Key Life Sciences Issues in Visakhapatnam
Visakhapatnam's life sciences sector faces a distinct set of digital challenges. These are the issues driving demand for digital solutions in India.
Digital Transformation Adoption
Visakhapatnam's life sciences sector is navigating rapid digital transformation — with businesses across India under pressure to modernise operations, customer experiences, and data management to remain competitive in South Asia's evolving market. Digital platforms tailored to the life sciences sector are providing the tools and infrastructure that Visakhapatnam's businesses need to transform efficiently and effectively.
Regulatory & Compliance Pressure
India's regulatory environment is tightening across the life sciences sector, with new compliance requirements creating operational burdens for Visakhapatnam's businesses. Digital compliance management platforms — automating monitoring, documentation, and reporting workflows — are helping Visakhapatnam's life sciences operators meet South Asia's regulatory requirements without proportional increases in overhead.
Talent & Skills Access
Visakhapatnam's life sciences sector faces a growing talent gap as demand for digitally skilled professionals outpaces the supply available in India's labour market. Digital workforce platforms — covering recruitment, training, remote work management, and skills assessment — are helping Visakhapatnam's life sciences businesses attract, develop, and retain the talent their growth strategies require across South Asia.
Data-Driven Decision Making
Businesses in Visakhapatnam's life sciences sector are sitting on vast amounts of operational, customer, and market data — but most lack the analytics infrastructure to extract real insight in India's fast-moving commercial environment. Digital analytics platforms and business intelligence tools are enabling Visakhapatnam's life sciences operators to make faster, more confident decisions based on real-time data rather than intuition.
Common Questions
Visakhapatnam Digital Life Sciences — FAQ
What is Visakhapatnam Digital Life Sciences?
Visakhapatnam Digital Life Sciences is the dedicated digital solutions network for life sciences in Visakhapatnam, India. Digital life sciences encompasses the data, research, and technology platforms that support pharmaceutical development, clinical trials, genomics, and medical research. Tools include laboratory… It operates as a city node within Digital World Networks' global infrastructure spanning 351 industry networks and 642 cities worldwide.
What digital life sciences solutions are available in Visakhapatnam?
The Visakhapatnam Digital Life Sciences network currently lists 20 verified life sciences providers available to Visakhapatnam businesses and residents. These include platforms, tools, and services operating within or serving the India's South Asia market through the Digital World Networks platform.
How does the Visakhapatnam Digital Life Sciences network connect to Digital World Networks?
Visakhapatnam Digital Life Sciences is a Level 5 city node within the Digital World Networks (DWN) hierarchy. DWN operates as the global infrastructure layer (Level 1) at DigitalWorldNetworks.com, with industry-specific networks at Level 4 and city+industry combinations at Level 5. The Visakhapatnam node gives local businesses and residents direct access to digital life sciences solutions vetted and distributed through the DWN platform.
How can I list my life sciences solutions on the Visakhapatnam Digital Life Sciences network?
To list your digital life sciences solutions or partner with the Visakhapatnam Digital Life Sciences network, contact the Digital World Networks team at hello@digitalworldnetworks.com or call 305-250-3939. Digital World Networks distributes verified digital solutions across 351 industry networks and 642 cities — reach the full Visakhapatnam market and beyond.
City Networks
Explore Other Industries in Visakhapatnam
Discover more digital solutions across Visakhapatnam's industry networks
Global Network
Explore Digital Life Sciences in Other Cities
More Digital Life Sciences city networks across South Asia
Digital Bank Networks
Digital Banking in Visakhapatnam
Visakhapatnam has a dedicated digital banking portal within the Digital Bank Networks ecosystem — connecting verified fintech and banking solutions for the Visakhapatnam market.
City Portal
Visakhapatnam Digital Bank
visakhapatnamdigitalbank.com
Dedicated banking hub for Visakhapatnam
Industry Hub
Digital Bank Networks
digitalbanknetworks.com
Global banking solutions network
Finance Hub
Digital Finance Hub
DWN / digitalfinance
375 city banking portals index
List Your Solutions
Visakhapatnam Life Sciences providers —
join this network
To list your life sciences digital solutions or partner with this city network, reach out to the Digital World Networks team.