DigitalWorldNetworks.com
A Digital World Networks Company

Visakhapatnam Digital Life Sciences

The dedicated digital solutions network for Life Sciences in Visakhapatnam, India — part of the Digital World Networks global infrastructure serving South Asia.

20

Solutions Listed

20

Categories

1

Verified Programs

351Industry Networks642Cities Worldwide11,199+Digital SolutionsVerified & Reviewed

Visakhapatnam Life Sciences Solutions

Digital Life Sciences Providers

Verified digital life sciences solutions available to Visakhapatnam businesses and residents through the Digital World Networks platform.

Research & Reference Management

EndNote

endnote.com

Verified

The reference manager trusted by millions of researchers at the world's top universities. Summarize, translate, organize, and cite with ease — building ideas, one citation at a time.

Life Sciences Research ToolsVisit →

Benchling

Website

benchling.com

Benchling is a cloud-based platform for biotechnology research and development and the only biology-first platform for scientific data

BenchlingVisit →

https://digitalinsights.qiagen.com

QIAGEN Digital Insights

digitalinsights.qiagen.com/products/clc-genomics-workbench

CLC Genomics Workbench Premium delivers flexible, scalable sequence analysis software for NGS data interpretation in any research environment.

https://digitalinsights.qiagen.comVisit →

https://labcollector.com

LabCollector

scinote.net

SciNote is a cloud-based ELN software with lab inventory, compliance, & team management tools used by the FDA, USDA and scientists in 100+ countries.

https://labcollector.comVisit →

https://nanoporetech.com

Oxford Nanopore Technologies

pacb.com

PacBio highly accurate long-read sequencing provides the most comprehensive view of genomes, transcriptomes, and epigenomes.

https://nanoporetech.comVisit →

https://rosalind.bio

Rosalind Bioinformatics

genestack.com

A global player in life science R&D informatics. We provide pharma, agriscience and consumer goods organizations with Life Science Data management

https://rosalind.bioVisit →

https://usegalaxy.org

Galaxy Project (UseGalaxy)

seqera.io

Seqera empowers your teams with a unified environment that delivers high-throughput, cost-effective computation

https://usegalaxy.orgVisit →

https://www.avantorsciences.com

Avantor Science

cambridgescientific.com

We are a service company specializing in the sale of refurbished laboratory and scientific equipment for a variety of industries.

https://www.avantorsciences.comVisit →

https://www.benchsci.com

BenchSci

indicalab.com

Indica Labs uses AI to power its HALO software suite for an end-to-end digital pathology workflow from research to diagnostics.

https://www.benchsci.comVisit →

https://www.bio-rad.com

Bio-Rad Laboratories

abcam.com

Abcam, the leading supplier of protein research tools to life scientists. Abcam offers high-quality biological reagents and tools

https://www.bio-rad.comVisit →

https://www.bio-techne.com

Bio-Techne

cellsignal.com/products

For 25 years, the world's most trusted antibodies ; Featured Products & Services

https://www.bio-techne.comVisit →

https://www.biocompare.com

Biocompare

labplanet.com

We stock a wide selection of laboratory glassware, medical supplies,lab equipment, microscopes,chromatography products and so much more.

https://www.biocompare.comVisit →

https://www.bioconductor.org

Bioconductor

biobam.com

BioBam is a leading bioinformatics solution provider which accelerate research in disciplines such as agricultural genomics, microbiology and environmental NGS

https://www.bioconductor.orgVisit →

https://www.biovision.com

BioVision

zageno.com

ZAGENO offers a large marketplace with AI search, automated order tracking, real-time cost control, and 100% lab supply ordering automation.

https://www.biovision.comVisit →

https://www.caymanchem.com

Cayman Chemical

vectorlabs.com

Your Partner in Science. Explore antibodies, kits, and reagents for cutting-edge research. Elevate your experiments with us.

https://www.caymanchem.comVisit →

https://www.cellsignal.com

Cell Signaling Technology

scbt.com

SCBT is a leading producer of monoclonal antibodies, RNAi, CRISPR KO/Activation products and chemicals for research.

https://www.cellsignal.comVisit →

https://www.dnastar.com

DNASTAR Lasergene

macvector.com

MacVector is a sequence analysis application for Macintosh computers that lets you manipulate, document and analyze DNA and protein sequences.

https://www.dnastar.comVisit →

https://www.fishersci.com

Fisher Scientific

sigmaaldrich.com

MilliporeSigma offers consultative services to help customers optimize their workflows and overcome complex challenges in areas of life science research.

https://www.fishersci.comVisit →

https://www.flowjo.com

FlowJo

denovosoftware.com

FCS Express gets you from raw data to easily-understandable, beautifully formatted, presentation-ready results more easily and in less time than any other

https://www.flowjo.comVisit →

https://www.genewiz.com

Genewiz by Azenta

en.novogene.com

Novogene selects the best technology from Illumina, Pacific Biosciences, Oxford Nanopore and Life Technologies, in our state-of-the-art sequencing centers i

https://www.genewiz.comVisit →

About This Network

Visakhapatnam's dedicated
Life Sciences city network

IndiaSouth AsiaAsia

Visakhapatnam's position as India's South Asia hub makes it a key market for digital life sciences solutions. Digital life sciences encompasses the data, research, and technology platforms that support pharmaceutical development, clinical trials, genomics, and medical research. This city network connects Visakhapatnam businesses and residents with 20 verified life sciences providers across 20 solution categories, all operating within or serving the Visakhapatnam market through the Digital World Networks platform.

As India's major port city, Visakhapatnam plays a critical role in regional trade flows, digital logistics platforms, and maritime technology networks across South Asia.

Digital life sciences encompasses the data, research, and technology platforms that support pharmaceutical development, clinical trials, genomics, and medical research. Tools include laboratory information management systems (LIMS), clinical data management platforms, and bioinformatics pipelines for analyzing genetic and molecular data. Research institutions, biotech firms, and pharmaceutical companies are the primary users.

visakhapatnamdigitallifesciences.com

L1

DigitalWorldNetworks.com

Global parent

L4

DigitalLifeSciencesNetworks.com

Industry network

L5

visakhapatnamdigitallifesciences.com

This network

Challenges & Opportunities

Key Life Sciences Issues in Visakhapatnam

Visakhapatnam's life sciences sector faces a distinct set of digital challenges. These are the issues driving demand for digital solutions in India.

Digital Transformation Adoption

Visakhapatnam's life sciences sector is navigating rapid digital transformation — with businesses across India under pressure to modernise operations, customer experiences, and data management to remain competitive in South Asia's evolving market. Digital platforms tailored to the life sciences sector are providing the tools and infrastructure that Visakhapatnam's businesses need to transform efficiently and effectively.

Regulatory & Compliance Pressure

India's regulatory environment is tightening across the life sciences sector, with new compliance requirements creating operational burdens for Visakhapatnam's businesses. Digital compliance management platforms — automating monitoring, documentation, and reporting workflows — are helping Visakhapatnam's life sciences operators meet South Asia's regulatory requirements without proportional increases in overhead.

Talent & Skills Access

Visakhapatnam's life sciences sector faces a growing talent gap as demand for digitally skilled professionals outpaces the supply available in India's labour market. Digital workforce platforms — covering recruitment, training, remote work management, and skills assessment — are helping Visakhapatnam's life sciences businesses attract, develop, and retain the talent their growth strategies require across South Asia.

Data-Driven Decision Making

Businesses in Visakhapatnam's life sciences sector are sitting on vast amounts of operational, customer, and market data — but most lack the analytics infrastructure to extract real insight in India's fast-moving commercial environment. Digital analytics platforms and business intelligence tools are enabling Visakhapatnam's life sciences operators to make faster, more confident decisions based on real-time data rather than intuition.

Common Questions

Visakhapatnam Digital Life Sciences — FAQ

What is Visakhapatnam Digital Life Sciences?

Visakhapatnam Digital Life Sciences is the dedicated digital solutions network for life sciences in Visakhapatnam, India. Digital life sciences encompasses the data, research, and technology platforms that support pharmaceutical development, clinical trials, genomics, and medical research. Tools include laboratory… It operates as a city node within Digital World Networks' global infrastructure spanning 351 industry networks and 642 cities worldwide.

What digital life sciences solutions are available in Visakhapatnam?

The Visakhapatnam Digital Life Sciences network currently lists 20 verified life sciences providers available to Visakhapatnam businesses and residents. These include platforms, tools, and services operating within or serving the India's South Asia market through the Digital World Networks platform.

How does the Visakhapatnam Digital Life Sciences network connect to Digital World Networks?

Visakhapatnam Digital Life Sciences is a Level 5 city node within the Digital World Networks (DWN) hierarchy. DWN operates as the global infrastructure layer (Level 1) at DigitalWorldNetworks.com, with industry-specific networks at Level 4 and city+industry combinations at Level 5. The Visakhapatnam node gives local businesses and residents direct access to digital life sciences solutions vetted and distributed through the DWN platform.

How can I list my life sciences solutions on the Visakhapatnam Digital Life Sciences network?

To list your digital life sciences solutions or partner with the Visakhapatnam Digital Life Sciences network, contact the Digital World Networks team at hello@digitalworldnetworks.com or call 305-250-3939. Digital World Networks distributes verified digital solutions across 351 industry networks and 642 cities — reach the full Visakhapatnam market and beyond.

City Networks

Explore Other Industries in Visakhapatnam

Discover more digital solutions across Visakhapatnam's industry networks

Global Network

Explore Digital Life Sciences in Other Cities

More Digital Life Sciences city networks across South Asia

Digital Bank Networks

Digital Banking in Visakhapatnam

Visakhapatnam has a dedicated digital banking portal within the Digital Bank Networks ecosystem — connecting verified fintech and banking solutions for the Visakhapatnam market.

City Portal

Visakhapatnam Digital Bank

visakhapatnamdigitalbank.com

Dedicated banking hub for Visakhapatnam

Industry Hub

Digital Bank Networks

digitalbanknetworks.com

Global banking solutions network

Finance Hub

Digital Finance Hub

DWN / digitalfinance

375 city banking portals index

Global Network

296 City Portals

140 Countries

View all city portals →

List Your Solutions

Visakhapatnam Life Sciences providers —
join this network

To list your life sciences digital solutions or partner with this city network, reach out to the Digital World Networks team.

Made with AI in Macaly