DigitalWorldNetworks.com
A Digital World Networks Company

Visakhapatnam Digital Living Well

The dedicated digital solutions network for Living Well in Visakhapatnam, India — part of the Digital World Networks global infrastructure serving South Asia.

20

Solutions Listed

12

Categories

20

Verified Programs

351Industry Networks642Cities Worldwide11,199+Digital SolutionsVerified & Reviewed

Visakhapatnam Living Well Solutions

Digital Living Well Providers

Verified digital living well solutions available to Visakhapatnam businesses and residents through the Digital World Networks platform.

Telehealth

PeterMD

track.revoffers.com/aff_c?offer_id=1344&aff_id=12077

Verified

PeterMD is a leading telehealth platform offering physician-guided therapies for hormone optimization, weight loss, peptide therapy, NAD+, sexual wellness, and anti-aging. Every treatment plan is personalized by licensed medical professionals and shipped nationwide — no clinics, no waiting rooms. High lifetime value with recurring purchases across men's and women's health programs including Testosterone, Semaglutide, and longevity solutions.

Hormone Optimization & LongevityVisit →

PeterMD

track.revoffers.com/aff_c?offer_id=1344&aff_id=12077

Verified

PeterMD is a leading telehealth platform offering physician-guided therapies for hormone optimization, weight loss, peptide therapy, NAD+, sexual wellness, and anti-aging. Every treatment plan is personalized by licensed medical professionals and shipped nationwide — no clinics, no waiting rooms. High lifetime value with recurring purchases across men's and women's health programs including Testosterone, Semaglutide, and longevity solutions.

Hormone Optimization & LongevityVisit →

Sports Performance Nutrition & Supplements

Pura Vida

puravida.com.br

Verified

Pura Vida is a leading Brazilian premium health and wellness brand specializing in high-quality nutritional supplements, sports nutrition, and functional foods. Sold direct-to-consumer via puravida.com.br, the brand offers an extensive range of products including whey proteins, collagen, dietary supplements, multivitamins, creatine, omega-3, sports nutrition, healthy snacks, and relaxation & focus formulas. Backed by a prescribers program for healthcare professionals and a loyal Puravida Club membership community, Pura Vida combines science-based nutrition with a vibrant wellness lifestyle. Delivers throughout Brazil with free shipping on qualifying orders.

Athlete-Grade Protein, Creatine & Recovery SupplementsVisit →

Pura Vida

puravida.com.br

Verified

Pura Vida is a leading Brazilian premium health and wellness brand specializing in high-quality nutritional supplements, sports nutrition, and functional foods. Sold direct-to-consumer via puravida.com.br, the brand offers an extensive range of products including whey proteins, collagen, dietary supplements, multivitamins, creatine, omega-3, sports nutrition, healthy snacks, and relaxation & focus formulas. Backed by a prescribers program for healthcare professionals and a loyal Puravida Club membership community, Pura Vida combines science-based nutrition with a vibrant wellness lifestyle. Delivers throughout Brazil with free shipping on qualifying orders.

Athlete-Grade Protein, Creatine & Recovery SupplementsVisit →

Podcast & Audio Streaming Platform

Ivoox

ivoox.com

Verified

Ivoox is the leading Spanish-language podcast and audio streaming platform. Discover and listen to millions of podcasts, online radio stations, and audio content covering sport, science, culture, entertainment, music, wellness, and business & technology. Also a platform for podcast creators to publish and grow their audience.

Spanish-language podcasts, online radio & audio content across all categoriesVisit →

Ivoox

ivoox.com

Verified

Ivoox is the leading Spanish-language podcast and audio streaming platform. Discover and listen to millions of podcasts, online radio stations, and audio content covering sport, science, culture, entertainment, music, wellness, and business & technology. Also a platform for podcast creators to publish and grow their audience.

Spanish-language podcasts, online radio & audio content across all categoriesVisit →

Music & Frequency Therapy

Soul Link

soul-link.org

Verified

Soul Link unlocks personal wellness with science. By integrating music, videos, and frequency-based soundscapes, Soul Link pioneers a new era of well-being using advanced, science-driven technology. Their patent-pending system promotes cognitive engagement, emotional balance, and overall wellness. Available on App Store, Google Play, and Web — Soul Link is redefining how people connect with their mental and emotional health.

Music and soundscapes for wellness and cognitive engagementVisit →

Soul Link

soul-link.org

Verified

Soul Link unlocks personal wellness with science. By integrating music, videos, and frequency-based soundscapes, Soul Link pioneers a new era of well-being using advanced, science-driven technology. Their patent-pending system promotes cognitive engagement, emotional balance, and overall wellness. Available on App Store, Google Play, and Web — Soul Link is redefining how people connect with their mental and emotional health.

Music and soundscapes for wellness and cognitive engagementVisit →

Luxury Wellness Rituals

ilapothecary

ilapothecary.com

Verified

ilapothecary helps you discover your perfect wellness ritual. Personalized natural products for anxiety & stress relief, hormonal rebalance, muscle pain & inflammation, sleep & relaxation, and radiant skin & self-care. Tell them what your body needs and enjoy 10% off.

Personalized wellness products for stress, hormones, sleep, pain & skinVisit →

ilapothecary

ilapothecary.com

Verified

ilapothecary helps you discover your perfect wellness ritual. Personalized natural products for anxiety & stress relief, hormonal rebalance, muscle pain & inflammation, sleep & relaxation, and radiant skin & self-care. Tell them what your body needs and enjoy 10% off.

Personalized wellness products for stress, hormones, sleep, pain & skinVisit →

Adult Wellness eCommerce

Qumi

loveuce.com

Verified

Qumi offers premium adult wellness and intimacy products designed to empower personal well-being and self-care. Experience pleasure without shame and intimacy on your own terms. Free shipping with no minimum order. A curated collection for him and her, focused on body positivity and sexual wellness.

Online adult wellness retailer with free shippingVisit →

Qumi

loveuce.com

Verified

Qumi offers premium adult wellness and intimacy products designed to empower personal well-being and self-care. Experience pleasure without shame and intimacy on your own terms. Free shipping with no minimum order. A curated collection for him and her, focused on body positivity and sexual wellness.

Online adult wellness retailer with free shippingVisit →

Luxury Discount Retail & Designer Goods

Databazaar.com

databazaar.com

Verified

Databazaar.com is a BBB-accredited US luxury goods retailer — 'Luxury For Less' since 1999. Specialising in premium fragrances (Creed, Calvin Klein Eternity, and more), Italian leather bags and Tuscany Leather accessories, and luxury lifestyle products at discounted prices. With flat rate shipping of $7.95 and delivery in 5–7 business days within the United States, Databazaar makes luxury accessible for every occasion — from Father's Day gifts to everyday indulgence. Up to 30% off top brands.

Discounted Luxury Fragrances & Leather AccessoriesVisit →

Databazaar.com

databazaar.com

Verified

Databazaar.com is a BBB-accredited US luxury goods retailer — 'Luxury For Less' since 1999. Specialising in premium fragrances (Creed, Calvin Klein Eternity, and more), Italian leather bags and Tuscany Leather accessories, and luxury lifestyle products at discounted prices. With flat rate shipping of $7.95 and delivery in 5–7 business days within the United States, Databazaar makes luxury accessible for every occasion — from Father's Day gifts to everyday indulgence. Up to 30% off top brands.

Discounted Luxury Fragrances & Leather AccessoriesVisit →

Medical Supplies & Healthcare Products

WellBefore

wellbefore.com

Verified

WellBefore is a trusted medical supply store offering masks, gloves, test kits, wound care, diabetes care, respiratory supplies, nutritional supplements, mobility aids, and more. HSA & FSA eligible. Shop professional-grade health products for home and clinical use.

Diabetes care, diagnostics & monitoring, OTC & wellnessVisit →

Health & Wellness Supplements

Mars by GHC

marsghc.com

Verified

Mars by GHC is an all-things health and wellness brand built for life. Shop performance supplements, hair care, peptides, and curated wellness bundles. Science-backed formulations with free shipping on orders over $59.

Performance, hair, peptides & wellness bundles — built for lifeVisit →

Digital Payments

SBI Credit Card India

store.admitad.com/en/mail_away/?next=https%3A%2F%2Ftjzuh.com%2Fg%2Fhxn4dcyutjed59609bb78bc555c0f8%2F%3Futm_medium%3Demail%26utm_content%3Dwebsite_advcampaign_accepted%26utm_source%3Dhq_system&cd=84fe80f9&activity=azac7yzek1&message=website_advcampaign_accepted&tag=link_2&sent=2026-05-11

Verified

SBI Credit Cards are issued by State Bank of India — India's largest public sector bank. Choose from a wide range of cards including cashback, rewards, travel, and lifestyle credit cards. Trusted by over 19 million cardholders with exclusive offers, EMI options, and pan-India acceptance.

Credit CardsVisit →

SBI Credit Card India

store.admitad.com/en/mail_away/?next=https%3A%2F%2Ftjzuh.com%2Fg%2Fhxn4dcyutjed59609bb78bc555c0f8%2F%3Futm_medium%3Demail%26utm_content%3Dwebsite_advcampaign_accepted%26utm_source%3Dhq_system&cd=84fe80f9&activity=azac7yzek1&message=website_advcampaign_accepted&tag=link_2&sent=2026-05-11

Verified

SBI Credit Cards are issued by State Bank of India — India's largest public sector bank. Choose from a wide range of cards including cashback, rewards, travel, and lifestyle credit cards. Trusted by over 19 million cardholders with exclusive offers, EMI options, and pan-India acceptance.

Credit CardsVisit →

Science-Driven Wellness Supplements

BetterBrand

betterbrand.com

Verified

BetterBrand offers science-driven wellness supplements formulated by a Doctor of Pharmacy. Specializing in lung, liver, and gut health — BetterLungs is their flagship product for athletes, respiratory health, and daily wellness. Pure natural ingredients, no fillers or additives, evidence-based formulations.

Lung, liver & gut health supplements — natural, no fillers, pharmacist-formulatedVisit →

Expatriate Banking & Property Finance — UAE

Citibank UAE

citibank.ae

Verified

Citibank UAE is the United Arab Emirates division of Citi, one of the world's largest and most recognized global financial institutions. In the UAE, Citi offers a premium range of credit cards including the Citi Cashback Card, Citi Prestige, and Citi Ultima Mastercard — with rewards including up to AED 1,000 cashback, annual fee waivers, and instant discounts with leading UAE lifestyle brands such as Talabat and Careem. Citibank UAE also provides personal banking, wealth management, home finance, and international money transfers, making it a top choice for UAE residents, expatriates, and high-net-worth individuals. With a strong digital banking platform, 24/7 customer service, and a global network spanning 160+ countries, Citi is a trusted partner for financial services in the UAE and across the Gulf region.

Citibank UAE Home Finance & Mortgage Solutions for ExpatsVisit →

About This Network

Visakhapatnam's dedicated
Living Well city network

IndiaSouth AsiaAsia

Visakhapatnam's position as India's South Asia hub makes it a key market for digital living well solutions. Digital living well covers the platforms and lifestyle tools designed to improve quality of life — from work-life balance apps to habit tracking, ergonomic guidance, and preventive wellness programs. This city network connects Visakhapatnam businesses and residents with 20 verified living well providers across 12 solution categories, all operating within or serving the Visakhapatnam market through the Digital World Networks platform.

As India's major port city, Visakhapatnam plays a critical role in regional trade flows, digital logistics platforms, and maritime technology networks across South Asia.

Digital living well covers the platforms and lifestyle tools designed to improve quality of life — from work-life balance apps to habit tracking, ergonomic guidance, and preventive wellness programs. Solutions help individuals build sustainable routines across sleep, nutrition, movement, and relationships. It's for people prioritizing long-term health and wellbeing over short-term fixes.

visakhapatnamdigitallivingwell.com

L1

DigitalWorldNetworks.com

Global parent

L4

DigitalLivingWellNetworks.com

Industry network

L5

visakhapatnamdigitallivingwell.com

This network

Challenges & Opportunities

Key Living Well Issues in Visakhapatnam

Visakhapatnam's living well sector faces a distinct set of digital challenges. These are the issues driving demand for digital solutions in India.

Digital Transformation Adoption

Visakhapatnam's living well sector is navigating rapid digital transformation — with businesses across India under pressure to modernise operations, customer experiences, and data management to remain competitive in South Asia's evolving market. Digital platforms tailored to the living well sector are providing the tools and infrastructure that Visakhapatnam's businesses need to transform efficiently and effectively.

Regulatory & Compliance Pressure

India's regulatory environment is tightening across the living well sector, with new compliance requirements creating operational burdens for Visakhapatnam's businesses. Digital compliance management platforms — automating monitoring, documentation, and reporting workflows — are helping Visakhapatnam's living well operators meet South Asia's regulatory requirements without proportional increases in overhead.

Talent & Skills Access

Visakhapatnam's living well sector faces a growing talent gap as demand for digitally skilled professionals outpaces the supply available in India's labour market. Digital workforce platforms — covering recruitment, training, remote work management, and skills assessment — are helping Visakhapatnam's living well businesses attract, develop, and retain the talent their growth strategies require across South Asia.

Data-Driven Decision Making

Businesses in Visakhapatnam's living well sector are sitting on vast amounts of operational, customer, and market data — but most lack the analytics infrastructure to extract real insight in India's fast-moving commercial environment. Digital analytics platforms and business intelligence tools are enabling Visakhapatnam's living well operators to make faster, more confident decisions based on real-time data rather than intuition.

Common Questions

Visakhapatnam Digital Living Well — FAQ

What is Visakhapatnam Digital Living Well?

Visakhapatnam Digital Living Well is the dedicated digital solutions network for living well in Visakhapatnam, India. Digital living well covers the platforms and lifestyle tools designed to improve quality of life — from work-life balance apps to habit tracking, ergonomic guidance, and preventive wellness programs.… It operates as a city node within Digital World Networks' global infrastructure spanning 351 industry networks and 642 cities worldwide.

What digital living well solutions are available in Visakhapatnam?

The Visakhapatnam Digital Living Well network currently lists 20 verified living well providers available to Visakhapatnam businesses and residents. These include platforms, tools, and services operating within or serving the India's South Asia market through the Digital World Networks platform.

How does the Visakhapatnam Digital Living Well network connect to Digital World Networks?

Visakhapatnam Digital Living Well is a Level 5 city node within the Digital World Networks (DWN) hierarchy. DWN operates as the global infrastructure layer (Level 1) at DigitalWorldNetworks.com, with industry-specific networks at Level 4 and city+industry combinations at Level 5. The Visakhapatnam node gives local businesses and residents direct access to digital living well solutions vetted and distributed through the DWN platform.

How can I list my living well solutions on the Visakhapatnam Digital Living Well network?

To list your digital living well solutions or partner with the Visakhapatnam Digital Living Well network, contact the Digital World Networks team at hello@digitalworldnetworks.com or call 305-250-3939. Digital World Networks distributes verified digital solutions across 351 industry networks and 642 cities — reach the full Visakhapatnam market and beyond.

City Networks

Explore Other Industries in Visakhapatnam

Discover more digital solutions across Visakhapatnam's industry networks

Global Network

Explore Digital Living Well in Other Cities

More Digital Living Well city networks across South Asia

Digital Bank Networks

Digital Banking in Visakhapatnam

Visakhapatnam has a dedicated digital banking portal within the Digital Bank Networks ecosystem — connecting verified fintech and banking solutions for the Visakhapatnam market.

City Portal

Visakhapatnam Digital Bank

visakhapatnamdigitalbank.com

Dedicated banking hub for Visakhapatnam

Industry Hub

Digital Bank Networks

digitalbanknetworks.com

Global banking solutions network

Finance Hub

Digital Finance Hub

DWN / digitalfinance

375 city banking portals index

Global Network

296 City Portals

140 Countries

View all city portals →

List Your Solutions

Visakhapatnam Living Well providers —
join this network

To list your living well digital solutions or partner with this city network, reach out to the Digital World Networks team.

Made with AI in Macaly