Visakhapatnam Digital Smart City
The dedicated digital solutions network for Smart City in Visakhapatnam, India — part of the Digital World Networks global infrastructure serving South Asia.
20
Solutions Listed
6
Categories
0
Verified Programs
Visakhapatnam Smart City Solutions
Digital Smart City Providers
Verified digital smart city solutions available to Visakhapatnam businesses and residents through the Digital World Networks platform.
Smart City Citizen Services
Nextdoor for Public Agencies
nextdoor.com/agency
Public agencies partner with Nextdoor for crime prevention, community engagement, emergency preparedness, and community policing.
SeeClickFix
seeclickfix.com
SeeClickFix is a 311 request and work management app bridging the communication gap between residents and their local governments.
Smart City GIS & Geospatial
CARTO Location Intelligence
carto.com
CARTO is the Agentic GIS Platform. Go beyond traditional GIS. Scalable spatial analysis for all teams with your spatial data never leaving your cloud
Esri ArcGIS Mission
esri.com
Esri's GIS software is the most powerful mapping & spatial analytics technology available.
Esri ArcGIS Online
arcgis.com
Build interactive web maps with ArcGIS Online, Esri's web-based mapping software. Gain new perspectives and enhanced details as you interact with data.
Geocortex Essentials
geocortex.com
Build and configure targeted, purposeful, powerful web-mapping applications to deliver what your end-users need using Geocortex Essentials.
Mapbox
mapbox.com
APIs and SDKs for AI-powered maps, location search, turn-by-turn navigation, and geospatial data in mobile or web apps.
SafeGraph Places Data
safegraph.com
SafeGraph curates the highest quality and most up-to-date Places data to help organizations understand dynamically changing market trends
Smart City Government Platforms
ClearGov
cleargov.com
ClearGov® provides local governments cloud-based Budget Cycle Management software for efficient, collaborative, and automated budgeting.
SmartCity by CityBase
citybase.com
The simple, and safe way to buy domain names. No matter what kind of domain you want to buy or lease, we make the transfer simple and safe.
Zencity
zencity.io
With Zencity, government and law enforcement leaders make informed, transparent, and effective decisions that earn the trust of the communities they serve.
Smart City Emergency Management
Juvare WebEOC
juvare.com
Juvare's emergency management & critical operations solutions empower public, private, and healthcare organizations to anticipate disruptions
Smart City Open Data
OpenDataSoft
opendatasoft.com
With our data marketplace solution, centralize and share your data assets with all types of user in a simple, secure and interactive way.
Smart City Mobility & Transit
Citymapper
citymapper.com
Citymapper is a public transit app that provides real-time navigation and transport options for urban commuters, integrating walking, cycling, and public
Moovit
moovitapp.com
Looking for a bus app or a train app? Moovit is the most popular public transit app worldwide for all transit methods, including buses, trains, metros
Remix by Via
ridewithvia.com/remix
Remix is data-driven software for transit planning, using algorithms to model tradeoffs and integrate on-demand and fixed-route planning.
RideCo On-Demand Transit
rideco.com
RideCo is the most adopted on-demand cloud-based paratransit and microtransit software among the 10 largest cities in the United States.
Swiftly Transit Data Platform
goswift.ly
Power your network with the industry's leading data platform for knowing where your vehicles were, are, and will be next. goswiftly.
Transit App
transitapp.com
The world's most accurate transit app. Never miss a bus or train again on our 600+ supported cities, including New York, Paris, London, Montreal and more.
Via Transportation
ridewithvia.com
Via transforms transportation systems into highly efficient digital networks. Our flexible, end-to-end platform powers mobility for modern communities.
About This Network
Visakhapatnam's dedicated
Smart City city network
Visakhapatnam's position as India's South Asia hub makes it a key market for digital smart city solutions. Digital smart cities cover the IoT sensors, data platforms, and intelligent infrastructure systems that help urban governments manage city operations more efficiently and sustainably. This city network connects Visakhapatnam businesses and residents with 20 verified smart city providers across 6 solution categories, all operating within or serving the Visakhapatnam market through the Digital World Networks platform.
As India's major port city, Visakhapatnam plays a critical role in regional trade flows, digital logistics platforms, and maritime technology networks across South Asia.
Digital smart cities cover the IoT sensors, data platforms, and intelligent infrastructure systems that help urban governments manage city operations more efficiently and sustainably. Solutions include smart traffic management systems, connected utility monitoring platforms, city data analytics dashboards, and digital twin urban planning tools. Forward-thinking cities use smart city technology to reduce costs, improve services, and enhance quality of life.
L1
DigitalWorldNetworks.com
Global parent
L4
DigitalSmartCityNetworks.com
Industry network
L5
visakhapatnamdigitalsmartcity.com
This network
Challenges & Opportunities
Key Smart City Issues in Visakhapatnam
Visakhapatnam's smart city sector faces a distinct set of digital challenges. These are the issues driving demand for digital solutions in India.
Digital Transformation Adoption
Visakhapatnam's smart city sector is navigating rapid digital transformation — with businesses across India under pressure to modernise operations, customer experiences, and data management to remain competitive in South Asia's evolving market. Digital platforms tailored to the smart city sector are providing the tools and infrastructure that Visakhapatnam's businesses need to transform efficiently and effectively.
Regulatory & Compliance Pressure
India's regulatory environment is tightening across the smart city sector, with new compliance requirements creating operational burdens for Visakhapatnam's businesses. Digital compliance management platforms — automating monitoring, documentation, and reporting workflows — are helping Visakhapatnam's smart city operators meet South Asia's regulatory requirements without proportional increases in overhead.
Talent & Skills Access
Visakhapatnam's smart city sector faces a growing talent gap as demand for digitally skilled professionals outpaces the supply available in India's labour market. Digital workforce platforms — covering recruitment, training, remote work management, and skills assessment — are helping Visakhapatnam's smart city businesses attract, develop, and retain the talent their growth strategies require across South Asia.
Data-Driven Decision Making
Businesses in Visakhapatnam's smart city sector are sitting on vast amounts of operational, customer, and market data — but most lack the analytics infrastructure to extract real insight in India's fast-moving commercial environment. Digital analytics platforms and business intelligence tools are enabling Visakhapatnam's smart city operators to make faster, more confident decisions based on real-time data rather than intuition.
Common Questions
Visakhapatnam Digital Smart City — FAQ
What is Visakhapatnam Digital Smart City?
Visakhapatnam Digital Smart City is the dedicated digital solutions network for smart city in Visakhapatnam, India. Digital smart cities cover the IoT sensors, data platforms, and intelligent infrastructure systems that help urban governments manage city operations more efficiently and sustainably. Solutions… It operates as a city node within Digital World Networks' global infrastructure spanning 351 industry networks and 642 cities worldwide.
What digital smart city solutions are available in Visakhapatnam?
The Visakhapatnam Digital Smart City network currently lists 20 verified smart city providers available to Visakhapatnam businesses and residents. These include platforms, tools, and services operating within or serving the India's South Asia market through the Digital World Networks platform.
How does the Visakhapatnam Digital Smart City network connect to Digital World Networks?
Visakhapatnam Digital Smart City is a Level 5 city node within the Digital World Networks (DWN) hierarchy. DWN operates as the global infrastructure layer (Level 1) at DigitalWorldNetworks.com, with industry-specific networks at Level 4 and city+industry combinations at Level 5. The Visakhapatnam node gives local businesses and residents direct access to digital smart city solutions vetted and distributed through the DWN platform.
How can I list my smart city solutions on the Visakhapatnam Digital Smart City network?
To list your digital smart city solutions or partner with the Visakhapatnam Digital Smart City network, contact the Digital World Networks team at hello@digitalworldnetworks.com or call 305-250-3939. Digital World Networks distributes verified digital solutions across 351 industry networks and 642 cities — reach the full Visakhapatnam market and beyond.
City Networks
Explore Other Industries in Visakhapatnam
Discover more digital solutions across Visakhapatnam's industry networks
Global Network
Explore Digital Smart City in Other Cities
More Digital Smart City city networks across South Asia
Digital Bank Networks
Digital Banking in Visakhapatnam
Visakhapatnam has a dedicated digital banking portal within the Digital Bank Networks ecosystem — connecting verified fintech and banking solutions for the Visakhapatnam market.
City Portal
Visakhapatnam Digital Bank
visakhapatnamdigitalbank.com
Dedicated banking hub for Visakhapatnam
Industry Hub
Digital Bank Networks
digitalbanknetworks.com
Global banking solutions network
Finance Hub
Digital Finance Hub
DWN / digitalfinance
375 city banking portals index
List Your Solutions
Visakhapatnam Smart City providers —
join this network
To list your smart city digital solutions or partner with this city network, reach out to the Digital World Networks team.