DigitalWorldNetworks.com
A Digital World Networks Company

Visakhapatnam Digital Smart City

The dedicated digital solutions network for Smart City in Visakhapatnam, India — part of the Digital World Networks global infrastructure serving South Asia.

20

Solutions Listed

6

Categories

0

Verified Programs

351Industry Networks642Cities Worldwide11,199+Digital SolutionsVerified & Reviewed

Visakhapatnam Smart City Solutions

Digital Smart City Providers

Verified digital smart city solutions available to Visakhapatnam businesses and residents through the Digital World Networks platform.

Smart City Citizen Services

Nextdoor for Public Agencies

nextdoor.com/agency

Public agencies partner with Nextdoor for crime prevention, community engagement, emergency preparedness, and community policing.

Neighborhood Social Network for City CommunicationsVisit →

SeeClickFix

seeclickfix.com

SeeClickFix is a 311 request and work management app bridging the communication gap between residents and their local governments.

311 Civic Reporting & City Issue TrackingVisit →

Smart City GIS & Geospatial

CARTO Location Intelligence

carto.com

CARTO is the Agentic GIS Platform. Go beyond traditional GIS. Scalable spatial analysis for all teams with your spatial data never leaving your cloud

Location Intelligence & Urban AnalyticsVisit →

Esri ArcGIS Mission

esri.com

Esri's GIS software is the most powerful mapping & spatial analytics technology available.

Emergency & Mission Management GISVisit →

Esri ArcGIS Online

arcgis.com

Build interactive web maps with ArcGIS Online, Esri's web-based mapping software. Gain new perspectives and enhanced details as you interact with data.

City Mapping & Urban Intelligence PlatformVisit →

Geocortex Essentials

geocortex.com

Build and configure targeted, purposeful, powerful web-mapping applications to deliver what your end-users need using Geocortex Essentials.

Public Sector GIS & Spatial AnalyticsVisit →

Mapbox

mapbox.com

APIs and SDKs for AI-powered maps, location search, turn-by-turn navigation, and geospatial data in mobile or web apps.

Custom City Maps & Developer Mapping PlatformVisit →

SafeGraph Places Data

safegraph.com

SafeGraph curates the highest quality and most up-to-date Places data to help organizations understand dynamically changing market trends

Urban Places Data & Foot Traffic AnalyticsVisit →

Smart City Government Platforms

ClearGov

cleargov.com

ClearGov® provides local governments cloud-based Budget Cycle Management software for efficient, collaborative, and automated budgeting.

Government Budget Transparency & Financial DataVisit →

SmartCity by CityBase

citybase.com

The simple, and safe way to buy domain names. No matter what kind of domain you want to buy or lease, we make the transfer simple and safe.

City Payments, Permitting & Civic ServicesVisit →

Zencity

zencity.io

With Zencity, government and law enforcement leaders make informed, transparent, and effective decisions that earn the trust of the communities they serve.

AI-Powered Community Feedback & City AnalyticsVisit →

Smart City Emergency Management

Juvare WebEOC

juvare.com

Juvare's emergency management & critical operations solutions empower public, private, and healthcare organizations to anticipate disruptions

Crisis & Emergency Operations Center PlatformVisit →

Smart City Open Data

OpenDataSoft

opendatasoft.com

With our data marketplace solution, centralize and share your data assets with all types of user in a simple, secure and interactive way.

City Open Data Portal & Smart Data PublishingVisit →

Smart City Mobility & Transit

Citymapper

citymapper.com

Citymapper is a public transit app that provides real-time navigation and transport options for urban commuters, integrating walking, cycling, and public

Urban Mobility & Public Transit AppVisit →

Moovit

moovitapp.com

Looking for a bus app or a train app? Moovit is the most popular public transit app worldwide for all transit methods, including buses, trains, metros

Real-Time Transit & Multimodal Journey PlannerVisit →

Remix by Via

ridewithvia.com/remix

Remix is data-driven software for transit planning, using algorithms to model tradeoffs and integrate on-demand and fixed-route planning.

City Transit Planning & Mobility Design ToolVisit →

RideCo On-Demand Transit

rideco.com

RideCo is the most adopted on-demand cloud-based paratransit and microtransit software among the 10 largest cities in the United States.

Demand-Responsive Transit & Micro-Transit OperationsVisit →

Swiftly Transit Data Platform

goswift.ly

Power your network with the industry's leading data platform for knowing where your vehicles were, are, and will be next. goswiftly.

Real-Time Transit Data & Passenger InformationVisit →

Transit App

transitapp.com

The world's most accurate transit app. Never miss a bus or train again on our 600+ supported cities, including New York, Paris, London, Montreal and more.

Public Transit Tracking & City MobilityVisit →

Via Transportation

ridewithvia.com

Via transforms transportation systems into highly efficient digital networks. Our flexible, end-to-end platform powers mobility for modern communities.

On-Demand Transit & Smart Shuttle PlatformVisit →

About This Network

Visakhapatnam's dedicated
Smart City city network

IndiaSouth AsiaAsia

Visakhapatnam's position as India's South Asia hub makes it a key market for digital smart city solutions. Digital smart cities cover the IoT sensors, data platforms, and intelligent infrastructure systems that help urban governments manage city operations more efficiently and sustainably. This city network connects Visakhapatnam businesses and residents with 20 verified smart city providers across 6 solution categories, all operating within or serving the Visakhapatnam market through the Digital World Networks platform.

As India's major port city, Visakhapatnam plays a critical role in regional trade flows, digital logistics platforms, and maritime technology networks across South Asia.

Digital smart cities cover the IoT sensors, data platforms, and intelligent infrastructure systems that help urban governments manage city operations more efficiently and sustainably. Solutions include smart traffic management systems, connected utility monitoring platforms, city data analytics dashboards, and digital twin urban planning tools. Forward-thinking cities use smart city technology to reduce costs, improve services, and enhance quality of life.

visakhapatnamdigitalsmartcity.com

L1

DigitalWorldNetworks.com

Global parent

L4

DigitalSmartCityNetworks.com

Industry network

L5

visakhapatnamdigitalsmartcity.com

This network

Challenges & Opportunities

Key Smart City Issues in Visakhapatnam

Visakhapatnam's smart city sector faces a distinct set of digital challenges. These are the issues driving demand for digital solutions in India.

Digital Transformation Adoption

Visakhapatnam's smart city sector is navigating rapid digital transformation — with businesses across India under pressure to modernise operations, customer experiences, and data management to remain competitive in South Asia's evolving market. Digital platforms tailored to the smart city sector are providing the tools and infrastructure that Visakhapatnam's businesses need to transform efficiently and effectively.

Regulatory & Compliance Pressure

India's regulatory environment is tightening across the smart city sector, with new compliance requirements creating operational burdens for Visakhapatnam's businesses. Digital compliance management platforms — automating monitoring, documentation, and reporting workflows — are helping Visakhapatnam's smart city operators meet South Asia's regulatory requirements without proportional increases in overhead.

Talent & Skills Access

Visakhapatnam's smart city sector faces a growing talent gap as demand for digitally skilled professionals outpaces the supply available in India's labour market. Digital workforce platforms — covering recruitment, training, remote work management, and skills assessment — are helping Visakhapatnam's smart city businesses attract, develop, and retain the talent their growth strategies require across South Asia.

Data-Driven Decision Making

Businesses in Visakhapatnam's smart city sector are sitting on vast amounts of operational, customer, and market data — but most lack the analytics infrastructure to extract real insight in India's fast-moving commercial environment. Digital analytics platforms and business intelligence tools are enabling Visakhapatnam's smart city operators to make faster, more confident decisions based on real-time data rather than intuition.

Common Questions

Visakhapatnam Digital Smart City — FAQ

What is Visakhapatnam Digital Smart City?

Visakhapatnam Digital Smart City is the dedicated digital solutions network for smart city in Visakhapatnam, India. Digital smart cities cover the IoT sensors, data platforms, and intelligent infrastructure systems that help urban governments manage city operations more efficiently and sustainably. Solutions… It operates as a city node within Digital World Networks' global infrastructure spanning 351 industry networks and 642 cities worldwide.

What digital smart city solutions are available in Visakhapatnam?

The Visakhapatnam Digital Smart City network currently lists 20 verified smart city providers available to Visakhapatnam businesses and residents. These include platforms, tools, and services operating within or serving the India's South Asia market through the Digital World Networks platform.

How does the Visakhapatnam Digital Smart City network connect to Digital World Networks?

Visakhapatnam Digital Smart City is a Level 5 city node within the Digital World Networks (DWN) hierarchy. DWN operates as the global infrastructure layer (Level 1) at DigitalWorldNetworks.com, with industry-specific networks at Level 4 and city+industry combinations at Level 5. The Visakhapatnam node gives local businesses and residents direct access to digital smart city solutions vetted and distributed through the DWN platform.

How can I list my smart city solutions on the Visakhapatnam Digital Smart City network?

To list your digital smart city solutions or partner with the Visakhapatnam Digital Smart City network, contact the Digital World Networks team at hello@digitalworldnetworks.com or call 305-250-3939. Digital World Networks distributes verified digital solutions across 351 industry networks and 642 cities — reach the full Visakhapatnam market and beyond.

City Networks

Explore Other Industries in Visakhapatnam

Discover more digital solutions across Visakhapatnam's industry networks

Global Network

Explore Digital Smart City in Other Cities

More Digital Smart City city networks across South Asia

Digital Bank Networks

Digital Banking in Visakhapatnam

Visakhapatnam has a dedicated digital banking portal within the Digital Bank Networks ecosystem — connecting verified fintech and banking solutions for the Visakhapatnam market.

City Portal

Visakhapatnam Digital Bank

visakhapatnamdigitalbank.com

Dedicated banking hub for Visakhapatnam

Industry Hub

Digital Bank Networks

digitalbanknetworks.com

Global banking solutions network

Finance Hub

Digital Finance Hub

DWN / digitalfinance

375 city banking portals index

Global Network

296 City Portals

140 Countries

View all city portals →

List Your Solutions

Visakhapatnam Smart City providers —
join this network

To list your smart city digital solutions or partner with this city network, reach out to the Digital World Networks team.

Made with AI in Macaly